- Ly-6G5C Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91160
- Human
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: ADLPSCWGAG PCYTGHKVGA LRRDTVICCC RHGDYSTPCL FTPGKPSRNP SPWKRTLWT
- Ly-6G5C
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- C6orf20, G5C, LY6G5CA, LY6G5CB, NG33
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- lymphocyte antigen 6 family member G5C
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT
Specifications/Features
Available conjugates: Unconjugated